Iright
BRAND / VENDOR: Proteintech

Proteintech, 15531-1-AP, HRAS Polyclonal antibody

CATALOG NUMBER: 15531-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HRAS (15531-1-AP) by Proteintech is a Polyclonal antibody targeting HRAS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15531-1-AP targets HRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, PC-12 cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HeLa cells Positive IHC detected in: human stomach tissue, mouse intestineNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HRAS belongs to the small GTPase superfamily and Ras family. RAS family proteins (KRAS4A, KRAS4B, NRAS and HRAS) function as GDP-GTP-regulated binary on-off switches, which regulate cytoplasmic signaling networks that control diverse normal cellular processes (PMID: 26985062). HRAS is Involved in the activation of Ras protein signal transduction (PMID: 22821884). As HRAS mutations are associated to activation of RAF/MEK/ERK signaling in different cancers (PMID: 25435214). HRAS is mostly altered in head and neck squamous cell carcinoma (HNSCC) (5-9%), salivary glands (15%), and bladder cancer (5-30%) (PMID: 35621690). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7704 Product name: Recombinant human HRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC006499 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSSGTLWDPPGPM Predict reactive species Full Name: v-Ha-ras Harvey rat sarcoma viral oncogene homolog Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC006499 Gene Symbol: HRAS Gene ID (NCBI): 3265 RRID: AB_2878147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924