Iright
BRAND / VENDOR: Proteintech

Proteintech, 15541-1-AP, TRPT1 Polyclonal antibody

CATALOG NUMBER: 15541-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRPT1 (15541-1-AP) by Proteintech is a Polyclonal antibody targeting TRPT1 in IHC, ELISA applications with reactivity to human samples 15541-1-AP targets TRPT1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TRPT1 catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate. It has four isoforms with MW 22-24 and 27-29 kDa. Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7897 Product name: Recombinant human TRPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC005133 Sequence: MGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ Predict reactive species Full Name: tRNA phosphotransferase 1 Calculated Molecular Weight: 28 kDa GenBank Accession Number: BC005133 Gene Symbol: TRPT1 Gene ID (NCBI): 83707 RRID: AB_2878149 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86TN4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924