Iright
BRAND / VENDOR: Proteintech

Proteintech, 15553-1-AP, KCTD2/5/17 Polyclonal antibody

CATALOG NUMBER: 15553-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCTD2/5/17 (15553-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD2/5/17 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15553-1-AP targets KCTD2/5/17 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516). This polyclonal antibody raised against full-length recombinant protein of human KCTD5 (26 kDa) can cross-react with other KCTD proteins, including KCTD2 (29 kDa), KCTD17 (33-36 kDa). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7915 Product name: Recombinant human KCTD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC007314 Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM Predict reactive species Full Name: potassium channel tetramerisation domain containing 5 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC007314 Gene Symbol: KCTD5 Gene ID (NCBI): 54442 RRID: AB_2132155 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924