Iright
BRAND / VENDOR: Proteintech

Proteintech, 15557-1-AP, DIRAS2 Polyclonal antibody

CATALOG NUMBER: 15557-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DIRAS2 (15557-1-AP) by Proteintech is a Polyclonal antibody targeting DIRAS2 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15557-1-AP targets DIRAS2 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, rat brain tissue, HeLa cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GTP-binding protein Di-Ras2 (DIRAS2) is a member of the Ras-related small G-protein family. DIRAS2 regulated the phosphorylation of downstream effector proteins and activated the RAS/mitogen-activated protein kinase (MAPK) signaling pathway (PMID: 3216131). DIRAS2 interacted with 26S proteasome non-ATPase regulatory subunit 2, which facilitates the degradation of DIRAS2 in a proteasome-mediated way. DIRAS2 blocked nuclear factor kappa light-chain enhancer of activated B-cell (NF-κB) signaling pathways, inducing G0/G1 arrest. DIRAS2 inhibited CRC cell proliferation and affected cell-cycle protein expression (PMID: 35173535). DIRAS2 was proved to be an oncogene that activated the RAS-MAPK pathway to induce cell proliferation and metastasis in renal cell cancer (PMID: 3216131). DIRAS2 also shows its activity as a tumor-suppressor gene to induce autophagic cell death via modulating nuclear localization FOXO3/FOXO3A and TFEB (PMID: 29368982). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7926 Product name: Recombinant human DIRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC008065 Sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM Predict reactive species Full Name: DIRAS family, GTP-binding RAS-like 2 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC008065 Gene Symbol: DIRAS2 Gene ID (NCBI): 54769 RRID: AB_2261563 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96HU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924