Proteintech, 15581-1-AP, PCGF1 Polyclonal antibody

Size: 20ul / 150ul The PCGF1 (15581-1-AP) by Proteintech is a Polyclonal antibody targeting PCGF1 in WB, ELISA applications with reactivity to human samples 15581-1-AP targets PCGF1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PCGF1 (Polycomb group RING finger protein 1), also known as NSPC1. It is expected to be located in the nucleus. Human and mouse NSPc1 genes encode proteins with an N-terminal RING finger domain and share homology with Drosophila melanogaster lethal(3)73Ah and the mammalian Mel18 and Bmi1 genes. Transcripts are observed at 10 dpc in the otic vesicle, urogenital bud and dorsal root ganglia. At 11.5 dpc, transcripts are present in a subset of neural crest cell derivatives of the peripheral nervous system, and in the neural tube. NSPc1 expression is ubiquitous in adult tissue (PMID: 11287196). The molecular weight of PCGF1is 30 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7983 Product name: Recombinant human PCGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC004952 Sequence: MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR Predict reactive species Full Name: polycomb group ring finger 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30-31 kDa GenBank Accession Number: BC004952 Gene Symbol: PCGF1 Gene ID (NCBI): 84759 RRID: AB_3669212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.