Proteintech, 15601-1-AP, PSMG3 Polyclonal antibody

Size: 20ul / 150ul The PSMG3 (15601-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG3 in WB, IHC, ELISA applications with reactivity to human samples 15601-1-AP targets PSMG3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells, HeLa cells Positive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information PSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7984 Product name: Recombinant human PSMG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species Full Name: proteasome (prosome, macropain) assembly chaperone 3 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13-18 kDa GenBank Accession Number: BC004308 Gene Symbol: PSMG3 Gene ID (NCBI): 84262 RRID: AB_2878156 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BT73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.