Proteintech, 15608-1-AP, VRK3 Polyclonal antibody

Size: 20ul / 150ul The VRK3 (15608-1-AP) by Proteintech is a Polyclonal antibody targeting VRK3 in WB, IHC, ELISA applications with reactivity to human samples 15608-1-AP targets VRK3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7993 Product name: Recombinant human VRK3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-301 aa of BC023556 Sequence: MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENE Predict reactive species Full Name: vaccinia related kinase 3 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 50-53 kDa GenBank Accession Number: BC023556 Gene Symbol: VRK3 Gene ID (NCBI): 51231 RRID: AB_10863120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IV63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.