Iright
BRAND / VENDOR: Proteintech

Proteintech, 15609-1-AP, HAS3 Polyclonal antibody

CATALOG NUMBER: 15609-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HAS3 (15609-1-AP) by Proteintech is a Polyclonal antibody targeting HAS3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15609-1-AP targets HAS3 in WB, FC, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, L02 cells, mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information HAS3(hyaluronan synthase 3) belongs to the NodC/HAS family, which are widely expressed in human tissues and appear to function in embryogenesis, wound healing and other processes associated with cellular proliferation and migration(PMID:14566823). HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. It may play a role in the progression of colon cancer and, as such, may provide novel targets for diagnostic and therapeutic interventions(PMID:14566823). It has 2 isoforms produced by alternative splicing and the protein has a glycosylation site. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7999 Product name: Recombinant human HAS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-281 aa of BC021853 Sequence: MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ Predict reactive species Full Name: hyaluronan synthase 3 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC021853 Gene Symbol: HAS3 Gene ID (NCBI): 3038 RRID: AB_2232886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00219 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924