Proteintech, 15626-1-AP, Carboxypeptidase A2 Polyclonal antibody

Size: 20ul / 150ul The Carboxypeptidase A2 (15626-1-AP) by Proteintech is a Polyclonal antibody targeting Carboxypeptidase A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15626-1-AP targets Carboxypeptidase A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8080 Product name: Recombinant human CPA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-417 aa of BC014571 Sequence: REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY Predict reactive species Full Name: carboxypeptidase A2 (pancreatic) Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC014571 Gene Symbol: Carboxypeptidase A2 Gene ID (NCBI): 1358 RRID: AB_2276735 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48052 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.