Iright
BRAND / VENDOR: Proteintech

Proteintech, 15656-1-AP, Hexokinase 1 Polyclonal antibody

CATALOG NUMBER: 15656-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Hexokinase 1 (15656-1-AP) by Proteintech is a Polyclonal antibody targeting Hexokinase 1 in WB, IHC, ELISA applications with reactivity to human samples 15656-1-AP targets Hexokinase 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, U-87 MG cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The hexokinases (HKs) catalyze the first obligatory step in glucose metabolism to generate glucose-6-phosphate. This not only furthers glucose entry by maintaining the concentration gradient for facilitated glucose influx but also provides the first intermediate for essentially all major pathways using glucose. There are four conventional HK isoforms, HK1/2/3/4, encoded by four different genes. Most adult tissues express only HK1. Muscle and adipose tissue use HK2 for glycolysis, liver, and pancreatic beta cells express HK4 (also called glucokinase) and do not express HK1 or HK2. (PMID: 31434645, PMID: 31848318) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8008 Product name: Recombinant human HK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 583-917 aa of BC008730 Sequence: SDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS Predict reactive species Full Name: hexokinase 1 Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC008730 Gene Symbol: Hexokinase 1 Gene ID (NCBI): 3098 RRID: AB_2878162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924