Iright
BRAND / VENDOR: Proteintech

Proteintech, 15672-1-AP, NFKBID Polyclonal antibody

CATALOG NUMBER: 15672-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NFKBID (15672-1-AP) by Proteintech is a Polyclonal antibody targeting NFKBID in WB, ELISA applications with reactivity to human, mouse samples 15672-1-AP targets NFKBID in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A20 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NFKBID, also known as IkBNS, belongs to the IKB protein family of NFKB inhibitors and is induced by T-cell receptor stimulation(PMID: 11931770). NFKBID regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. NFKBID plays a role in regulating inflammatory responses. NFKBID is involved in the induction of T helper 17 cells (Th17) differentiation upon antigen recognition by T cell antigen receptor (TCR). (PMID: 25347393) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8139 Product name: Recombinant human NFKBID protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC006273 Sequence: MRSCCVVQAGLQLLASSDPPSSASQSARITGVNHRTPPREIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS Predict reactive species Full Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta Calculated Molecular Weight: 150 aa, 16 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC006273 Gene Symbol: NFKBID Gene ID (NCBI): 84807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924