Proteintech, 15680-1-AP, DLK2 Polyclonal antibody

Size: 20ul / 150ul The DLK2 (15680-1-AP) by Proteintech is a Polyclonal antibody targeting DLK2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 15680-1-AP targets DLK2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human liver tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8170 Product name: Recombinant human DLK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC006425 Sequence: MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL Predict reactive species Full Name: delta-like 2 homolog (Drosophila) Calculated Molecular Weight: 383aa,41 kDa; 204aa,21 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC006425 Gene Symbol: DLK2 Gene ID (NCBI): 65989 RRID: AB_2092804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UY11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.