Proteintech, 15687-1-AP, DLG5 Polyclonal antibody

Size: 20ul / 150ul The DLG5 (15687-1-AP) by Proteintech is a Polyclonal antibody targeting DLG5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 15687-1-AP targets DLG5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse kidney tissue, HeLa cells Positive IHC detected in: Human bowens diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Discs large homolog 5 (DLG5) belongs to the membrane-associated guanylate kinase (MAGUK) family. DLG5 participates in epithelial cell polarity maintenance and cancer development. DLG5 is highly expressed in normal tissues, but its expression is decreased in many cancers, such as bladder cancer, prostate cancer, breast cancer, and hepatocellular carcinoma (PMID: 32015336). Down-regulation of DLG5 is highly correlated with clinical tumor stage. In breast cancer, knockdown of DLG5 induces cell migration, and overexpression of DLG5 inhibits cell migration (PMID: 28169360). DLG5 has 3 isoforms with the molecular weight of 75, 214 and 240 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8194 Product name: Recombinant human DLG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1569-1919 aa of BC002915 Sequence: VRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGRCAWAWSGEQAAGKEAEAS Predict reactive species Full Name: discs, large homolog 5 (Drosophila) Calculated Molecular Weight: 1893 aa, 209 kDa Observed Molecular Weight: 75 kDa, 240 kDa GenBank Accession Number: BC002915 Gene Symbol: DLG5 Gene ID (NCBI): 9231 RRID: AB_10642568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.