Proteintech, 15694-1-AP, CCNJ Polyclonal antibody

Size: 20ul / 150ul The CCNJ (15694-1-AP) by Proteintech is a Polyclonal antibody targeting CCNJ in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15694-1-AP targets CCNJ in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCNJ (Cyclin-J) Belongs to the Cyclin family. Cyclin J is expressed in early Drosophila embryos, and it is essential for mediating intestinal epithelial cell recovery from bacterial pore-forming toxin attack in both Drosophila and mice. Upon TLR and IFN stimulation, cyclin J restrained macrophage inflammatory responses irrespective of the cell cycle control. Cyclin J interacted with CDKs and facilitated the phosphorylation of a set of CDK substrates, including FoxK1 and Drp1. Phosphorylation inhibited FoxK1-mediated expression of glycolytic genes by reducing FoxK1 nuclear localization. Cyclin J-CDK-dependent Drp1 phosphorylation also resulted in mitochondrial fission and the suppression of ROS production (PMID: 35412849). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8273 Product name: Recombinant human CCNJ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC043175 Sequence: MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER Predict reactive species Full Name: cyclin J Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC043175 Gene Symbol: CCNJ Gene ID (NCBI): 54619 RRID: AB_3085470 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T5M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.