Proteintech, 15698-1-AP, CLPP Polyclonal antibody

Size: 20ul / 150ul The CLPP (15698-1-AP) by Proteintech is a Polyclonal antibody targeting CLPP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15698-1-AP targets CLPP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, rat heart tissue, K-562 cells, mouse heart tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human liver cancer tissue, human kidney tissue, human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken, zebrafish, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8325 Product name: Recombinant human CLPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC002956 Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Predict reactive species Full Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 26 kDa, 30 kDa GenBank Accession Number: BC002956 Gene Symbol: CLPP Gene ID (NCBI): 8192 RRID: AB_2245115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.