Proteintech, 15706-1-AP, NOL6 Polyclonal antibody

Size: 20ul / 150ul The NOL6 (15706-1-AP) by Proteintech is a Polyclonal antibody targeting NOL6 in WB, ELISA applications with reactivity to human, mouse, rat samples 15706-1-AP targets NOL6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SGC-7901 cells, HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8378 Product name: Recombinant human NOL6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 947-1146 aa of BC008298 Sequence: MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV Predict reactive species Full Name: nucleolar protein family 6 (RNA-associated) Calculated Molecular Weight: 1146 aa, 128 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC008298 Gene Symbol: NOL6 Gene ID (NCBI): 65083 RRID: AB_2878169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6R4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.