Iright
BRAND / VENDOR: Proteintech

Proteintech, 15714-1-AP, NARS2 Polyclonal antibody

CATALOG NUMBER: 15714-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NARS2 (15714-1-AP) by Proteintech is a Polyclonal antibody targeting NARS2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15714-1-AP targets NARS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human liver tissue, human brain tissue, K-562 cells, mouse kidney tissue Positive IHC detected in: human kidney tissue, human heart tissue, human lung tissue, human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial) is a nuclear-encoded enzyme that functions within the mitochondria, the energy-producing organelles of the cell. It belongs to the class II family of aminoacyl-tRNA synthetases (aaRSs), a group of essential enzymes responsible for protein synthesis. Its proper function is indispensable for mitochondrial protein synthesis and energy production, and its deficiency underlies a spectrum of severe human metabolic and neurological diseases. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8345 Product name: Recombinant human NARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-477 aa of BC007800 Sequence: ERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL Predict reactive species Full Name: asparaginyl-tRNA synthetase 2, mitochondrial (putative) Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 50-54 kDa GenBank Accession Number: BC007800 Gene Symbol: NARS2 Gene ID (NCBI): 79731 RRID: AB_2151157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96I59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924