Proteintech, 15727-1-AP, MFAP5 Polyclonal antibody

Size: 20ul / 150ul The MFAP5 (15727-1-AP) by Proteintech is a Polyclonal antibody targeting MFAP5 in WB, IHC, ELISA applications with reactivity to human samples 15727-1-AP targets MFAP5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human colon tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8467 Product name: Recombinant human MFAP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-173 aa of BC005901 Sequence: NSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL Predict reactive species Full Name: microfibrillar associated protein 5 Calculated Molecular Weight: 173 aa, 20 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC005901 Gene Symbol: MFAP5 Gene ID (NCBI): 8076 RRID: AB_2266295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13361 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.