Iright
BRAND / VENDOR: Proteintech

Proteintech, 15732-1-AP, HSPB11 Polyclonal antibody

CATALOG NUMBER: 15732-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPB11 (15732-1-AP) by Proteintech is a Polyclonal antibody targeting HSPB11 in WB, ELISA applications with reactivity to human, mouse, rat samples 15732-1-AP targets HSPB11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information HSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8490 Product name: Recombinant human HSPB11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC005245 Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS Predict reactive species Full Name: heat shock protein family B (small), member 11 Calculated Molecular Weight: 144 aa, 16 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC005245 Gene Symbol: HSPB11 Gene ID (NCBI): 51668 RRID: AB_2279933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y547 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924