Iright
BRAND / VENDOR: Proteintech

Proteintech, 15746-1-AP, ALDH3B2 Polyclonal antibody

CATALOG NUMBER: 15746-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALDH3B2 (15746-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH3B2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15746-1-AP targets ALDH3B2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, BxPC-3 cells, HepG2 cells Positive IHC detected in: human adrenal gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ALDH3B2(aldehyde dehydrogenase family 3 member B2) is also named as ALDH8(aldehyde dehydrogenase 8) and belongs to the aldehyde dehydrogenase family. The ALDH3B2 gene contains an in-frame stop codon at the seventeenth codon position from the first methionine,suggesting that ALDH3B2 may be a pseudogene(PMID:15237855) and encodes the human salivary gland and placental ALDH(PMID: 22206977). This protein shares 83% sequence identity with ALDH3B1(PMID:18611112 ). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8197 Product name: Recombinant human ALDH3B2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-385 aa of BC007685 Sequence: TGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL Predict reactive species Full Name: aldehyde dehydrogenase 3 family, member B2 Calculated Molecular Weight: 395 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC007685 Gene Symbol: ALDH3B2 Gene ID (NCBI): 222 RRID: AB_2242461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48448 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924