Proteintech, 15747-1-AP, NPHP5/IQCB1 Polyclonal antibody

Size: 20ul / 150ul The NPHP5/IQCB1 (15747-1-AP) by Proteintech is a Polyclonal antibody targeting NPHP5/IQCB1 in WB, IP, ELISA applications with reactivity to human samples 15747-1-AP targets NPHP5/IQCB1 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information IQCB1, also known as NPHP5, is a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. It has a central coiled-coil region and two calmodulin-binding IQ domains. Localized to the primary cilia of renal epithelial cells and connecting cilia of photoreceptor cells, IQCB1 is thought to play a role in ciliary function. Mutations in this gene result in Senior-Loken syndrome type 5, a juvenile disorder characterized by defects in the waste filtering system of the kidney, as well as retinal degradation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8203 Product name: Recombinant human NPHP5,IQCB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC005806 Sequence: MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKYRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELH Predict reactive species Full Name: IQ motif containing B1 Calculated Molecular Weight: 598 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC005806 Gene Symbol: IQCB1 Gene ID (NCBI): 9657 RRID: AB_2878179 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15051 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.