Proteintech, 15778-1-AP, ENY2 Polyclonal antibody

Size: 20ul / 150ul The ENY2 (15778-1-AP) by Proteintech is a Polyclonal antibody targeting ENY2 in WB, IHC, ELISA applications with reactivity to human samples 15778-1-AP targets ENY2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ENY2, also named as DC6, is involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. It is required for nuclear receptor-mediated transactivation. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). The MW of ENY2 is about 10 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8462 Product name: Recombinant human ENY2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC007870 Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL Predict reactive species Full Name: enhancer of yellow 2 homolog (Drosophila) Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC007870 Gene Symbol: ENY2 Gene ID (NCBI): 56943 RRID: AB_2878184 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPA8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.