Iright
BRAND / VENDOR: Proteintech

Proteintech, 15789-1-AP, PIN4 Polyclonal antibody

CATALOG NUMBER: 15789-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIN4 (15789-1-AP) by Proteintech is a Polyclonal antibody targeting PIN4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15789-1-AP targets PIN4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, mouse brain tissue, mouse kidney tissue Positive IHC detected in: human liver cancer tissue, human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PIN4, also known as EPVH, hPar14, is a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. PIN4 is the first eukaryotic member of the parvulin family of PPIases and contains a PPIase domain preceded by a 40-amino acid glycine- and lysine-rich N-terminal sequence. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8489 Product name: Recombinant human PIN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-140 aa of BC005234 Sequence: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Predict reactive species Full Name: protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) Calculated Molecular Weight: 131 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005234 Gene Symbol: PIN4 Gene ID (NCBI): 5303 RRID: AB_2878186 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y237 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924