Iright
BRAND / VENDOR: Proteintech

Proteintech, 15790-1-AP, TNFAIP8 Polyclonal antibody

CATALOG NUMBER: 15790-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TNFAIP8 (15790-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15790-1-AP targets TNFAIP8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells, PC-13 cells, MOLT-4 cells Positive IHC detected in: human lung cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TNFAIP8 (tumor necrosis factor, alpha-induced protein 8), also called SCC-S2/GG2-1/NDED, is associated with enhanced cell survival and inhibition of apoptosis. The induction of TNFAIP8 by TNF depends on the activation of NFκB. TNFAIP8 suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. TNFAIP8 is expressed in adult spleen, lymph node, thymus, thyroid, bone marrow, and placenta, and in fetal liver, lung, and kidney at high levels, also expressed in various tumor tissues and all cancer cell lines tested. There are four major isoforms of TNFAIP8. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8491 Product name: Recombinant human TNFAIP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC007014 Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 8 Calculated Molecular Weight: 198 aa, 23 kDa Observed Molecular Weight: 19-23 kDa GenBank Accession Number: BC007014 Gene Symbol: TNFAIP8 Gene ID (NCBI): 25816 RRID: AB_10792805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924