Proteintech, 15791-1-AP, SMPX Polyclonal antibody

Size: 20ul / 150ul The SMPX (15791-1-AP) by Proteintech is a Polyclonal antibody targeting SMPX in WB, IHC, ELISA applications with reactivity to human, pig samples 15791-1-AP targets SMPX in WB, IHC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig skeletal muscle tissue, human skeletal muscle tissue, human colon tissue, pig colon tissue Positive IHC detected in: human kidney tissue, human brain tissue, human lung tissue, human ovary tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8497 Product name: Recombinant human SMPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC005948 Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ Predict reactive species Full Name: small muscle protein, X-linked Calculated Molecular Weight: 88 aa, 10 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC005948 Gene Symbol: SMPX Gene ID (NCBI): 23676 RRID: AB_2193527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.