Proteintech, 15797-1-AP, ATPAF1 Polyclonal antibody

Size: 20ul / 150ul The ATPAF1 (15797-1-AP) by Proteintech is a Polyclonal antibody targeting ATPAF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15797-1-AP targets ATPAF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells Positive IHC detected in: human ovary cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8506 Product name: Recombinant human ATPAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-328 aa of BC008498 Sequence: GLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT Predict reactive species Full Name: ATP synthase mitochondrial F1 complex assembly factor 1 Calculated Molecular Weight: 328 aa, 36 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC008498 Gene Symbol: ATPAF1 Gene ID (NCBI): 64756 RRID: AB_2243354 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TC12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.