Proteintech, 15810-1-AP, ANP32A Polyclonal antibody

Size: 20ul / 150ul The ANP32A (15810-1-AP) by Proteintech is a Polyclonal antibody targeting ANP32A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 15810-1-AP targets ANP32A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, human brain tissue, mouse brain tissue, mouse thymus tissue, Raji cells, HeLa cells, MCF-7 cells, HEK-293T cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, A2780 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ANP32A, an acidic leucine-rich nuclear phosphoprotein, is a member of the inhibitor of the histone acetyltransferase (INHAT) complex and preferentially binds to unmodified histone H3 tails in vitro. ANP32A is expressed in normal tissues as well as in pancreatic, breast and prostate cancer and other malignant tumors. ANP32A plays an important role in cell proliferation, apoptosis, transcriptional regulation, signal transduction and other processes. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8546 Product name: Recombinant human ANP32A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC007200 Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD Predict reactive species Full Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A Calculated Molecular Weight: 249 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC007200 Gene Symbol: ANP32A Gene ID (NCBI): 8125 RRID: AB_2056302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P39687 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.