Proteintech, 15843-1-AP, PLA2G1B Polyclonal antibody

Size: 20ul / 150ul The PLA2G1B (15843-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G1B in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 15843-1-AP targets PLA2G1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse spleen tissue, rat pancreas tissue, pig pancreas tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8603 Product name: Recombinant human PLA2G1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species Full Name: phospholipase A2, group IB (pancreas) Calculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC005386 Gene Symbol: PLA2G1B Gene ID (NCBI): 5319 RRID: AB_2878190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04054 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.