Proteintech, 15853-1-AP, FXYD3 Polyclonal antibody

Size: 20ul / 150ul The FXYD3 (15853-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15853-1-AP targets FXYD3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, A375 cells, SGC-7901 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FXYD3 (also known as Mat-8) is one of the seven members of Fxyd3 protein family, belonging to a small molecular auxiliary subunit with single transmembrane, and its extracellular segment contains conservative Fxyd3 sequence motifs. By combining the α/β catalytic core of Na/K-ATPase, this family can finely adjust the ionic affinity and kinetics of the pump in different tissues, cell types and physiological states, without affecting the overall expression of the enzyme. It is mainly expressed in stomach, colon, pancreas, prostate, skin and other epithelium, showing obvious tissue specificity, and is significantly up-regulated in breast cancer, pancreatic cancer, colorectal cancer, prostate cancer, renal cell cancer, cholangiocarcinoma and psoriasis lesions, and is related to disease progression and chemotherapy resistance. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8672 Product name: Recombinant human FXYD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC005238 Sequence: MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS Predict reactive species Full Name: FXYD domain containing ion transport regulator 3 Calculated Molecular Weight: 87 aa, 9 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC005238 Gene Symbol: FXYD3 Gene ID (NCBI): 5349 RRID: AB_2108602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14802 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.