Iright
BRAND / VENDOR: Proteintech

Proteintech, 15867-1-AP, THYN1 Polyclonal antibody

CATALOG NUMBER: 15867-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The THYN1 (15867-1-AP) by Proteintech is a Polyclonal antibody targeting THYN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15867-1-AP targets THYN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, mouse lung tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information THYN1, also named as THY28, is a 28-32 kDa protein which located mainly in the nucleus. It appears to correlate with induction of apoptosis. (PMID:14601557) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8481 Product name: Recombinant human THYN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC006978 Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILF Predict reactive species Full Name: thymocyte nuclear protein 1 Calculated Molecular Weight: 225aa,26 kDa; 166aa,19 kDa Observed Molecular Weight: 28-32 kDa GenBank Accession Number: BC006978 Gene Symbol: THYN1 Gene ID (NCBI): 29087 RRID: AB_2287179 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P016 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924