Iright
BRAND / VENDOR: Proteintech

Proteintech, 15877-1-AP, Centrin 2 Polyclonal antibody

CATALOG NUMBER: 15877-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Centrin 2 (15877-1-AP) by Proteintech is a Polyclonal antibody targeting Centrin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15877-1-AP targets Centrin 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Centrin 2 is also named as CALT, or CEN2. It plays a fundamental role in microtubule-organizing center structure and function. Oxidizing radiation induces polymerization of centrin 2 into dimers, tetramers, hexamers,and even higher molecular mass species, as a function of the radiation dose(PMID:17603931).It exsits as a 21-kD polypeptide specifically localized to the centrosome of interphase and mitotic cells in both HeLa and BHK cells (PMID:8248209). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8638 Product name: Recombinant human Centrin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC005334 Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY Predict reactive species Full Name: centrin, EF-hand protein, 2 Calculated Molecular Weight: 172 aa, 20 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005334 Gene Symbol: Centrin 2 Gene ID (NCBI): 1069 RRID: AB_2077383 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924