Product Description
Size: 20ul / 150ul
The LSM3 (15879-1-AP) by Proteintech is a Polyclonal antibody targeting LSM3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
15879-1-AP targets LSM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells
Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: NIH/3T3 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
Background Information
LSM3, as a U6 snRNA-associated Sm-like protein, plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag8641 Product name: Recombinant human LSM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC007055 Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG Predict reactive species
Full Name: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Calculated Molecular Weight: 102 aa, 12 kDa
Observed Molecular Weight: 12 kDa
GenBank Accession Number: BC007055
Gene Symbol: LSM3
Gene ID (NCBI): 27258
RRID: AB_3669222
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P62310
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924