Iright
BRAND / VENDOR: Proteintech

Proteintech, 15881-1-AP, Sorbitol dehydrogenase Polyclonal antibody

CATALOG NUMBER: 15881-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Sorbitol dehydrogenase (15881-1-AP) by Proteintech is a Polyclonal antibody targeting Sorbitol dehydrogenase in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15881-1-AP targets Sorbitol dehydrogenase in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human kidney tissue, rat liver tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SORD(Sorbitol dehydrogenase) is also named as L-iditol 2-dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. It catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase, makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications. This protein can form a homotetramer(PMID:12962626). Measurement of SORD is a specific indicator of liver cell damage and parenchymal. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8651 Product name: Recombinant human SORD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC021085 Sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP Predict reactive species Full Name: sorbitol dehydrogenase Calculated Molecular Weight: 357 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC021085 Gene Symbol: SORD Gene ID (NCBI): 6652 RRID: AB_2192275 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924