Iright
BRAND / VENDOR: Proteintech

Proteintech, 15883-1-AP, UFM1 Polyclonal antibody

CATALOG NUMBER: 15883-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UFM1 (15883-1-AP) by Proteintech is a Polyclonal antibody targeting UFM1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 15883-1-AP targets UFM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, HEK-293 cells, HepG2 cells, mouse liver tissue, mouse lung tissue, L02 cells, U-251 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UFM1 (Ubiquitin-fold modifier 1) is a ubiquitin-like protein covalently conjugated with intracellular proteins through UFMylation (modification by UFM1), a process similar to ubiquitylation (PMID: 38141606). UFM1 is conjugated to its target proteins by E1-like activating enzyme UBE1DC1 and E2-like conjugating enzyme UFC1 in a manner analogous to ubiquitylation (PMID: 28234446; 33066455). At the molecular level, UFMylation is an important mediator of the protein function. Dysregulation of the UFM1 system, e.g., the knockout of UFMylation components, disturbs proteome homeostasis and triggers endoplasmic reticulum stress. Such changes are linked to developmental disorders, tumorigenesis, tissue injury, inflammation, and several hereditary neurological syndromes (PMID: 36932998). Western blot images showed that bands larger than 100kd may be proteins modified by UFM1. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8667 Product name: Recombinant human UFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC005193 Sequence: MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC Predict reactive species Full Name: ubiquitin-fold modifier 1 Calculated Molecular Weight: 85 aa, 9 kDa Observed Molecular Weight: 9-12 kDa GenBank Accession Number: BC005193 Gene Symbol: UFM1 Gene ID (NCBI): 51569 RRID: AB_2878195 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61960 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924