Iright
BRAND / VENDOR: Proteintech

Proteintech, 15889-1-AP, NDUFA2 Polyclonal antibody

CATALOG NUMBER: 15889-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFA2 (15889-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15889-1-AP targets NDUFA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse liver tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information NDUFA2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2), also known as NADH ubiquinone oxidoreductase B8 subunit, is one of accessory subunits of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFS2 is vital for growth, ROS generation, membrane integrity, apoptosis, and mitochondrial energetics. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8675 Product name: Recombinant human NDUFA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC003674 Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa Calculated Molecular Weight: 99 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC003674 Gene Symbol: NDUFA2 Gene ID (NCBI): 4695 RRID: AB_3669223 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924