Iright
BRAND / VENDOR: Proteintech

Proteintech, 15890-1-AP, INPP4B Polyclonal antibody

CATALOG NUMBER: 15890-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INPP4B (15890-1-AP) by Proteintech is a Polyclonal antibody targeting INPP4B in WB, IHC, ELISA applications with reactivity to human samples 15890-1-AP targets INPP4B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information INPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8676 Product name: Recombinant human INPP4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC005273 Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD Predict reactive species Full Name: inositol polyphosphate-4-phosphatase, type II, 105kDa Calculated Molecular Weight: 53 aa, 6 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC005273 Gene Symbol: INPP4B Gene ID (NCBI): 8821 RRID: AB_3669224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15327 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924