Iright
BRAND / VENDOR: Proteintech

Proteintech, 15933-1-AP, TIPRL Polyclonal antibody

CATALOG NUMBER: 15933-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TIPRL (15933-1-AP) by Proteintech is a Polyclonal antibody targeting TIPRL in WB, ELISA applications with reactivity to human, mouse, rat samples 15933-1-AP targets TIPRL in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information TIPRL, also known as TIP, TIP4, is an inhibitory regulator of protein phosphatase-2A (PP2A) , PP4, and PP6(PMID: 17384681). TIPRL, an evolutionarily conserved protein, plays a critical role in mediating γ-H2AX signal transduction upon DNA damage(PMID: 26717153). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8780 Product name: Recombinant human TIPRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC009506 Sequence: MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIPGGGHL Predict reactive species Full Name: TIP41, TOR signaling pathway regulator-like (S. cerevisiae) Calculated Molecular Weight: 178 aa, 20 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC009506 Gene Symbol: TIPRL Gene ID (NCBI): 261726 RRID: AB_3669227 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75663 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924