Iright
BRAND / VENDOR: Proteintech

Proteintech, 15955-1-AP, RILPL2 Polyclonal antibody

CATALOG NUMBER: 15955-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RILPL2 (15955-1-AP) by Proteintech is a Polyclonal antibody targeting RILPL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15955-1-AP targets RILPL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, THP-1 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8704 Product name: Recombinant human RILPL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC013042 Sequence: MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT Predict reactive species Full Name: Rab interacting lysosomal protein-like 2 Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC013042 Gene Symbol: RILPL2 Gene ID (NCBI): 196383 RRID: AB_2923561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924