Iright
BRAND / VENDOR: Proteintech

Proteintech, 15961-1-AP, MBD5 Polyclonal antibody

CATALOG NUMBER: 15961-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MBD5 (15961-1-AP) by Proteintech is a Polyclonal antibody targeting MBD5 in WB, ELISA applications with reactivity to human, mouse samples 15961-1-AP targets MBD5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information In vertebrates, cytosine methylation in DNA is one of the major epigenetic modifications, which regulates many cellular events, including developmental gene expression, X chromosome inactivation, genome defense, and genomic imprinting. DNA methylation exerts regulatory functions by recruiting specific binding proteins that contain a highly conserved methyl-CpG binding domain (MBD) [PMID:12610534,16403636]. Methyl-CpG binding domain protein 5 (MBD5) belongs to the MBD family proteins, which play central roles in transcriptional regulation and development. It is a candidate gene involved in human 2q23.1 microdeletion syndrome [PMID:23077600]. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8728 Product name: Recombinant human MBD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC014534 Sequence: MPLNQILNQHNAASFPASSLLSAAAKAQLANQNKLAGNNSSSSSNSGAVAGSGNTEGHSTLNTMFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY Predict reactive species Full Name: methyl-CpG binding domain protein 5 Calculated Molecular Weight: 292 aa, 31 kDa, 160 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: BC014534 Gene Symbol: MBD5 Gene ID (NCBI): 55777 RRID: AB_2281588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P267 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924