Proteintech, 15962-1-AP, Cystatin A Polyclonal antibody

Size: 20ul / 150ul The Cystatin A (15962-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 15962-1-AP targets Cystatin A in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human saliva tissue, NIH/3T3 cells, A549 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cystatin A (CSTA) is a member of the cystatin superfamily, which are thiol proteinase inhibitors (TPI) that play crucial roles in regulating proteolytic activity. It is a small protein composed of 98 amino acids with a molecular weight of approximately 11 kDa. CSTA is primarily expressed in epithelial tissues, such as the skin and esophagus, where it serves as a precursor protein for the cornified cell envelope in keratinocytes. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8733 Product name: Recombinant human CSTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010379 Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF Predict reactive species Full Name: cystatin A (stefin A) Calculated Molecular Weight: 98 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC010379 Gene Symbol: Cystatin A Gene ID (NCBI): 1475 RRID: AB_10641043 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.