Iright
BRAND / VENDOR: Proteintech

Proteintech, 15964-1-AP, BNIP1 Polyclonal antibody

CATALOG NUMBER: 15964-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BNIP1 (15964-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15964-1-AP targets BNIP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BNIP1 is a member of the BCL2/adenovirus E1B 19 kDa-interacting protein (BNIP) family. The encoded protein is predominantly localized to the endoplasmic reticulum (ER), is a pro-apoptotic Bcl-2 homology domain 3 (BH3)-only protein. BNIP1, also called SEC20L, is a component of a SNARE complex consisting of STX18, USE1L, BNIP1/SEC20L and SEC22B which is involved in apoptosis and ER membrane fusion. Recent reports showed that expression of BNIP1 induced mitochondrial fragmentation in a BH3 domain-dependent manner via increasing dynamin-related protein 1 (Drp1) expression. RNF185 is a mitochondrial ubiquitin E3 ligase that regulates selective mitochondrial autophagy, BNIP1 colocalizes with RNF185 at mitochondria and is polyubiquitinated by RNF185 through K63-based ubiquitin linkage in vivo and modulatemitochondrial homeostasis through autophagy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8737 Product name: Recombinant human BNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-228 aa of BC010959 Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL Predict reactive species Full Name: BCL2/adenovirus E1B 19kDa interacting protein 1 Calculated Molecular Weight: 228 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC010959 Gene Symbol: BNIP1 Gene ID (NCBI): 662 RRID: AB_2066636 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924