Product Description
Size: 20ul / 150ul
The IMMP2L (15970-1-AP) by Proteintech is a Polyclonal antibody targeting IMMP2L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
15970-1-AP targets IMMP2L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human kidney tissue, human heart tissue, mouse skeletal muscle tissue
Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag8752 Product name: Recombinant human IMMP2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC008497 Sequence: MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRDGRKLKRI Predict reactive species
Full Name: IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
Calculated Molecular Weight: 12 kDa, 20 kDa
Observed Molecular Weight: 12 kDa
GenBank Accession Number: BC008497
Gene Symbol: IMMP2L
Gene ID (NCBI): 83943
RRID: AB_2233868
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96T52
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924