Proteintech, 15971-1-AP, CLIC3 Polyclonal antibody

Size: 20ul / 150ul The CLIC3 (15971-1-AP) by Proteintech is a Polyclonal antibody targeting CLIC3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15971-1-AP targets CLIC3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: JAR cells, human placenta tissue, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume (PMID: 9880541). CLIC3 (chloride intracellular channel protein 3) belongs to the chloride channel CLIC family which has seven members based on sequence homology to the p64 chloride channels of bovine kidney microsomes. CLIC proteins lack the membrane-spanning domains characteristic of channel proteins and are largely intracellular. CLIC3 is predominantly localized in the nucleus and has a high expression level in placenta (PMID: 9880541; 17027078). It associates with the C-terminal of ERK7 and may participate in cellular growth control. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8757 Product name: Recombinant human CLIC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC007012 Sequence: MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR Predict reactive species Full Name: chloride intracellular channel 3 Calculated Molecular Weight: 236 aa, 26 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC007012 Gene Symbol: CLIC3 Gene ID (NCBI): 9022 RRID: AB_2229648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95833 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.