Iright
BRAND / VENDOR: Proteintech

Proteintech, 15993-1-AP, LLGL2 Polyclonal antibody

CATALOG NUMBER: 15993-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LLGL2 (15993-1-AP) by Proteintech is a Polyclonal antibody targeting LLGL2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 15993-1-AP targets LLGL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, MCF-7 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Lethal giant larvae (Lgl) is a scaffolding protein that regulates the establishment of apical-basal polarity in epithelial cells. The human homologs of Lgl are known as LLGL1 and LLGL2. LLGL1 is a tumor suppressor in multiple human cancers, including hepatocellular carcinoma, malignant melanoma, and colorectal cancer (PMID: 34178676; 15735678; 16170365). LLGL2 functions as a promoter of tumor growth and not as a tumor suppressor in ER+ breast cancer (PMID: 30996345). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8867 Product name: Recombinant human LLGL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-356 aa of BC010879 Sequence: MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAASRRASGVGAQG Predict reactive species Full Name: lethal giant larvae homolog 2 (Drosophila) Calculated Molecular Weight: 356aa,40 kDa; 1020aa,113 kDa Observed Molecular Weight: 113-120 kDa GenBank Accession Number: BC010879 Gene Symbol: LLGL2 Gene ID (NCBI): 3993 RRID: AB_3085478 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P1M3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924