Product Description
Size: 20ul / 150ul
The STAU2 (15998-1-AP) by Proteintech is a Polyclonal antibody targeting STAU2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
15998-1-AP targets STAU2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag8482 Product name: Recombinant human STAU2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC008370 Sequence: MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR Predict reactive species
Full Name: staufen, RNA binding protein, homolog 2 (Drosophila)
Calculated Molecular Weight: 570 aa, 62 kDa
Observed Molecular Weight: 62-66 kDa
GenBank Accession Number: BC008370
Gene Symbol: STAU2
Gene ID (NCBI): 27067
RRID: AB_10863121
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NUL3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924