Proteintech, 16004-1-AP, NBR1 Polyclonal antibody

Size: 20ul / 150ul The NBR1 (16004-1-AP) by Proteintech is a Polyclonal antibody targeting NBR1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 16004-1-AP targets NBR1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HeLa cells, COS-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse heart tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NBR1, also named as 1A13B, KIAA0049 and M17S2, acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets. NBR1 and P62 can bind to autophagic effector proteins (Atg8 in yeast, MAP1LC3 protein family in mammals) anchored in the membrane of autophagosomes. It is a highly conserved multidomain scaffold protein with proposed roles in endocytic trafficking and selective autophagy. NBR1 is a novel PB1 adapter in Th2 differentiation and asthma. It functions as an autophagy receptor involved in targeting ubiquitinated proteins for degradation. It also has a dual role as a scaffold protein to regulate growth-factor receptor and downstream signaling pathways. Observed MW of NBR1 is 140 kDa (PMID: 22654911, PMID: 22484440). Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8652 Product name: Recombinant human NBR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC009808 Sequence: MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ Predict reactive species Full Name: neighbor of BRCA1 gene 1 Calculated Molecular Weight: 966 aa, 107 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC009808 Gene Symbol: NBR1 Gene ID (NCBI): 4077 RRID: AB_2251178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14596 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.