Proteintech, 16026-1-AP, BCL2L2 Polyclonal antibody

Size: 20ul / 150ul The BCL2L2 (16026-1-AP) by Proteintech is a Polyclonal antibody targeting BCL2L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16026-1-AP targets BCL2L2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8863 Product name: Recombinant human BCL2L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC021198 Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR Predict reactive species Full Name: BCL2-like 2 Calculated Molecular Weight: 193 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC021198 Gene Symbol: BCL2L2 Gene ID (NCBI): 599 RRID: AB_2827646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92843 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.