Proteintech, 16027-1-AP, S100A1 Polyclonal antibody

Size: 20ul / 150ul The S100A1 (16027-1-AP) by Proteintech is a Polyclonal antibody targeting S100A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 16027-1-AP targets S100A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue Positive IHC detected in: human malignant melanoma tissue, human kidney tissue, human ovary tumor tissue, human appendicitis tissue, human tonsillitis tissue, rat brain tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human ovary cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8871 Product name: Recombinant human S100A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species Full Name: S100 calcium binding protein A1 Calculated Molecular Weight: 94 aa, 11 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC014392 Gene Symbol: S100A1 Gene ID (NCBI): 6271 RRID: AB_2183214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.