Proteintech, 16028-1-AP, MANBAL Polyclonal antibody

Size: 20ul / 150ul The MANBAL (16028-1-AP) by Proteintech is a Polyclonal antibody targeting MANBAL in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16028-1-AP targets MANBAL in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8888 Product name: Recombinant human MANBAL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-85 aa of BC014672 Sequence: MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR Predict reactive species Full Name: mannosidase, beta A, lysosomal-like Calculated Molecular Weight: 85 aa, 10 kDa GenBank Accession Number: BC014672 Gene Symbol: MANBAL Gene ID (NCBI): 63905 RRID: AB_2139582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.