Iright
BRAND / VENDOR: Proteintech

Proteintech, 16041-1-AP, IFFO1 Polyclonal antibody

CATALOG NUMBER: 16041-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFFO1 (16041-1-AP) by Proteintech is a Polyclonal antibody targeting IFFO1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16041-1-AP targets IFFO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, mouse testis tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information IFFO1, also named as IFFO and Tumor antigen HOM-TES-103, is a member of the intermediate filament family which consists of primordial components of the cytoskeleton and nuclear envelope that are mainly distributed in the nucleus, followed by the cytoskeleton and cytoplasm. IFFO1 in the nucleus was identified to combine with both XRCC4 and the nuclear lamina protein lamin A/C to be involved in nonhomologous DNA end joining (NHEJ). The expression of IFFO1 is associated with tumor progression. IFFO1 could be used as a potential marker to differentiate malignant ascites cell-free tumor DNA (cftDNA) of ovarian cancer from benign controls. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8915 Product name: Recombinant human IFFO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-294 aa of BC004384 Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR Predict reactive species Full Name: intermediate filament family orphan 1 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC004384 Gene Symbol: IFFO1 Gene ID (NCBI): 25900 RRID: AB_2121676 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0D2I5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924